PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_40231_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family HD-ZIP
Protein Properties Length: 281aa    MW: 31241.1 Da    PI: 8.1527
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_40231_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox54.52e-17130184256
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     rk+ +++keq   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  Neem_40231_f_1 130 RKKLRLSKEQSLLLEETFKEHSTLNPKQKLVLAKQLNLRPRQVEVWFQNRRARTK 184
                     788899***********************************************98 PP

2HD-ZIP_I/II124.64.7e-40130219191
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                     +kk+rlskeq+ lLEe+F+e+++L+p++K  la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+kev+eLr +l
  Neem_40231_f_1 130 RKKLRLSKEQSLLLEETFKEHSTLNPKQKLVLAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCENLTEENRRLQKEVQELR-AL 219
                     69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046185.4E-371101IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.602.8E-18108184IPR009057Homeodomain-like
SuperFamilySSF466898.98E-19117187IPR009057Homeodomain-like
PROSITE profilePS5007117.054126186IPR001356Homeobox domain
SMARTSM003894.5E-15128190IPR001356Homeobox domain
CDDcd000862.91E-14130187No hitNo description
PfamPF000466.8E-15130184IPR001356Homeobox domain
PROSITE patternPS000270161184IPR017970Homeobox, conserved site
SMARTSM003405.7E-27186229IPR003106Leucine zipper, homeobox-associated
PfamPF021832.3E-11186220IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MGEKDDGLGL SLSLGCARNE PAALKLNLVP FSSSHSMQNL HQRNCWNELF QSSDRNSDTR  60
SFLRGIDVNR APSAADCEED NGVSSPNSTI SSLSGKRSER ELIGDETEAE RASCSRGSDD  120
EDGGTGDGSR KKLRLSKEQS LLLEETFKEH STLNPKQKLV LAKQLNLRPR QVEVWFQNRR  180
ARTKLKQTEV DCEYLKRCCE NLTEENRRLQ KEVQELRALK LSPQLYMHMN PPTTLTMCPS  240
CERVAVSSSS SAAASGLAPN GSTRRPVPMS PWAALPIPHR S
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1128134SRKKLRL
2178186RRARTKLKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006445396.11e-164hypothetical protein CICLE_v10021501mg
RefseqXP_006464444.11e-164PREDICTED: homeobox-leucine zipper protein ATHB-4
SwissprotP466021e-114HAT3_ARATH; Homeobox-leucine zipper protein HAT3
TrEMBLA0A067HCG81e-164A0A067HCG8_CITSI; Uncharacterized protein
TrEMBLV4U8Y01e-164V4U8Y0_9R
STRINGPOPTR_0002s13720.11e-139(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25772772
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60390.11e-105homeobox-leucine zipper protein 3